Search
0
Items
Select
Search
MENU
Select

LL 37 (human)

Cat. No. AM-001

Structure:

H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Other Names:

Ropocamptide, hCAP 18, Cathelicidin LL 37, LL37, LL-37

Activity:

Host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide
Price Qty
LL 37 is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. In addition to its antimicrobial properties, LL 37 modulates numerous pathways in autoimmune and inflammatory diseases and has a role in the pathogenesis of lupus, RA and atherosclerosis. As a binding partner to Aβ42, LL 37 expression impacts initiation and progression of Alzheimer's disease. LL 37 also has a significant role in human cancer, inducing tumourigenic effects in cancers of the ovary, lung, breast, prostate, pancreas, and also in malignant melanoma.

Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 https://doi.org/10.4049/jimmunol.1302005

Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 doi:10.1002/biof.1225

Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 doi: 10.1159/000490183

Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL‑37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325


Technical Data

Structure H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS Number 154947-66-7
Molecular Weight 4493.3
Formula C205H341N61O52
Sequence [LL-37, 37 aa]
Modifications None

Solubility and Storage

Solubility Soluble in physiological buffers including PBS (>1mg/mL). Soluble in DMSO as a stock
Appearance Freeze dried solid
Storage Store dry, dark and frozen

Batch Specific Data

Purity >95% by HPLC
Certificate of Analysis LL 37 - CoA_600f391ddbf77.doc
Safety Data Sheet LL 37 (human) MSDS_602bef617ecd8.pdf

Contact Information

To place an order, or for customer services, order processing or technical support please contact us on:

Tel: (+44) 01392 422205

Fax: (+44) 01392 279510


[email protected]